PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG008365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 331aa    MW: 36602.9 Da    PI: 6.7856
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG008365.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.3e-393392261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  CCG008365.1 33 NQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 92
                 6899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-273191IPR003851Zinc finger, Dof-type
PfamPF027012.6E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQDTRSIEGG GRLFGGGDGG GGDRKLRPHH HQNQQALKCP RCDSLNTKFC YYNNYNLSQP  60
RHFCKSCRRY WTKGGVLRNV PVGGGCRKTK RSKLKQNTPT TTCDTITASS TTPQELQEQH  120
QQRDHKSSDS HSSSESSSLT ATNNTNANTT AEAVSALSVS SVVSNNLLNG IVESKIFPHG  180
NVNPSFEPSL LEQGSDCGIF SEIGSFTSLI TSTNDLFGFS NMMNQHQPPH QQQGLEHHVQ  240
HNQNQQQWQN HQQQEMTGGG GWINQTVRVE LSALPSSRST KNDDGEFEAL DWPLGSGDQA  300
TSLFDLPNAV DQAYWSQSQW NDQDHPSLYI P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1916GGRLFGGG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091050.0AC209105.1 Populus trichocarpa clone POP086-P02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000532.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLB9I2T11e-165B9I2T1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s12670.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-37OBF binding protein 4